VIP Peptide Specifications – Purity, Identity & Documentation Guide

Understanding VIP peptide specifications is an important part of evaluating vasoactive intestinal peptide research products.

A commercial listing may display a compound name, quantity, purity percentage, analytical information, and price.

However, these specifications answer different questions.

Researchers should evaluate them individually rather than treating a single number—such as purity—as proof of overall product quality.

What Is VIP Peptide?

VIP stands for vasoactive intestinal peptide.

It is a defined 28-amino-acid neuropeptide investigated in experimental systems involving:

• VPAC1 signaling
• VPAC2 signaling
• GPCR pathways
• cAMP-associated signaling
• Gastrointestinal physiology
• Intestinal epithelial biology
• Immune-cell responses
• Cytokine and chemokine signaling
• Inflammatory pathways
• Neuroimmune research

Exact molecular identity should be the starting point for product evaluation.

Specification 1: Compound Identity

The research material should clearly correspond to:

Vasoactive Intestinal Peptide (VIP)

This is particularly important because “VIP” is an extremely common acronym outside peptide research.

A product labeled only with vague terminology such as:

“intestinal peptide”

“immune peptide”

or

“signaling peptide”

doesn’t provide sufficiently specific molecular identification.

Specification 2: Peptide Length

VIP is a 28-amino-acid peptide.

Peptide length is one component of molecular identification.

Researchers should compare available molecular information with the expected VIP structure.

Specification 3: Peptide Sequence

Sequence information provides a more precise molecular reference.

The human VIP sequence is commonly represented as:

HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂

The C-terminal amide is part of the mature peptide’s molecular description.

Researchers should therefore consider both amino-acid order and relevant terminal modification when reviewing molecular information.

Specification 4: Quantity

Quantity describes how much research material is supplied.

Researchers should calculate requirements according to:

• Experimental conditions
• Controls
• Replicates
• Time points
• Number of assays
• Repeated experiments

Quantity and purity shouldn’t be confused.

Specification 5: Purity

A reported purity percentage can provide useful analytical information.

Researchers should ask:

• What percentage is reported?
• Which analytical method generated it?
• Which sample was tested?
• Which batch does it represent?
• Is supporting documentation available?

Specification 6: HPLC

High-performance liquid chromatography is commonly used in peptide analysis.

HPLC can provide information about chromatographic purity.

Researchers should review the analytical result in context rather than assuming that the largest percentage automatically represents the strongest product.

Specification 7: Molecular Identity Testing

Purity doesn’t independently establish molecular identity.

Researchers should separately review available analytical information supporting the identity of vasoactive intestinal peptide.

Specification 8: Certificate of Analysis

A COA may contain:

• Product identification
• Batch or lot
• Analytical method
• Purity
• Identity-related results
• Additional specifications

Researchers should examine the document rather than relying only on the statement “COA available.”

Specification 9: Batch or Lot

A batch identifier can connect analytical documentation with the research material being evaluated.

Researchers shouldn’t automatically assume that results associated with one batch characterize all future batches.

Specification 10: Product Configuration

Researchers should distinguish between:

standalone VIP peptide

and

multi-compound research configurations.

The correct choice depends on the experimental protocol.

Browse Current VIP Research Products

https://peptideslabus.com/products?q=VIP

This catalog provides a central location for reviewing current VIP research products.

Individual VIP Research Product

https://peptideslabus.com/products/crown-vip

Researchers can review the current product specifications directly from the live listing.

Additional VIP Product

https://peptideslabus.com/products/peptides-lab-vip

This provides another standalone product listing for evaluation.

Gastrointestinal Research Bundle

https://peptideslabus.com/products/crown-gastrointestinal-research-bundle

Researchers conducting broader gastrointestinal experiments can determine whether the bundle configuration fits their research protocol.

Specification 11: Receptor Context

VIP primarily signals through:

VPAC1

and

VPAC2

Both are class B GPCRs.

Receptor expression can differ across tissues and cell types.

For research planning, researchers should understand which receptor system is relevant to their experimental model.

What About PAC1?

PAC1 belongs to the related PACAP/VIP receptor family.

However, PAC1 is principally PACAP-preferring.

It shouldn’t be presented as an equivalent primary VIP receptor alongside VPAC1 and VPAC2.

Specification 12: Current Price

Price should be considered together with:

• Quantity
• Molecular identity
• Purity
• Testing
• Documentation
• Product configuration

Price alone doesn’t establish quality.

Specification 13: Current Availability

Inventory can change.

Researchers should use the live catalog immediately before procurement:

https://peptideslabus.com/products?q=VIP

Purity Isn’t Quantity

A listed quantity describes how much research material is supplied.

A purity percentage describes an analytical characteristic.

They aren’t interchangeable.

Purity Isn’t Identity

Likewise:

purity

and

molecular identity

answer different analytical questions.

Researchers should evaluate both.

Scientific Context Isn’t a Commercial Specification

VIP has been investigated in immune, inflammatory, gastrointestinal, receptor-signaling, and neuroimmune systems.

Those research findings don’t establish the purity, identity, quantity, or quality of a commercial product.

VIP Specification Checklist

Before ordering, verify:

Compound: Vasoactive Intestinal Peptide

Length: 28 amino acids

Sequence: Appropriate molecular sequence and terminal modification

Quantity: Listed amount

Purity: Reported analytical result

HPLC: Available chromatographic information

Identity testing: Supporting analytical information

COA: Relevant certificate

Batch: Applicable lot information

Configuration: Standalone or multi-compound research format

Price: Current live price

Availability: Current listing status

Browse VIP Research Products

https://peptideslabus.com/products?q=VIP

Researchers should evaluate VIP using a complete specification profile rather than relying on one purity percentage, product name, or price point.

For laboratory research purposes only.